Inhibits fibrinogen interaction with platelet receptors expressed on glycoprotein IIb-IIIa complex. Acts by binding to the glycoprotein IIb-IIIa receptor on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen. VMJA_BOTJA ERDLLVAVTMDHELGHNLGIRHDTGSCSCGGYSCVMSPVISHDISKYFSDCSYIQCWDFIMKENPQCILNKHLRTDTVSTPVSGNELLEAGEECDCGTPGNPCCDAATCKLRPGAQCAEGLCCDQCRFKGAGKICRRARGDNPDDRCTGQSADCPRNRFHA Venom metalloproteinase Platelet aggregation activation inhibitor Disintegrin jararacin Disintegrin jararacin-AGEEC This protein is a zinc protease from snake venom that acts in hemorrhage (By similarity). Disintegrin jararacin-GEEC 161 Zinc metalloproteinase/disintegrin Disintegrin jararacin-EC (Fragment)